← Find More Emojis with AI

🫸🏽🫸🏽 Rightwards Pushing Hand: Medium Skin Tone Emoji: Meaning & Usage

The rightwards pushing hand emoji depicts a hand gesture signaling to push or move something away.

Unicode: U+1FAF8 U+1F3FD

rejection emojidenial emojidisinterest emojidismissal emojirefusal emojipushing away emojishooing emoji

Meaning and Symbolism of 🫸🏽

Hand gesture signaling rejection, denial, or pushing something away.

The rightwards pushing hand emoji represents a hand gesture that suggests pushing something away, rejecting an idea or proposal, or indicating a dismissive or shooing motion. It can also convey a sense of denial, refusal, or disinterest. This emoji is often used in digital communication to express a range of emotions and intentions.

also known aspushing handshoo handstop emojidismiss hand

Popular Usage and Context

  • Expressing rejection or denial
  • Indicating disinterest or dismissal
  • Signaling a desire to stop or end a conversation
  • Conveying a sense of pushing something away figuratively or literally
  • Emphasizing a strong negative response or disagreement

Real-Life Message Examples with 🫸🏽

No thanks, I'll pass. 🫸🏽

Can we change the subject? 🫸🏽

I'm not interested in that idea. 🫸🏽

Popular Emoji Combos

🫸🏽✋Pushing back a hand to reject an offer
🫸🏽👎Rejecting something with a thumbs down
🫸🏽😤Pushing away frustration or annoyance
🫸🏽🚪Pushing someone out the door, dismissing them

Tone & Vibe

dismissivedefensivesarcasticsternplayful
Formality
3/10
Positivity
3/10
Intensity
5/10

History & Origin

Introduced in Unicode Emoji 15.0 (2022), this emoji was created to depict a hand pushing away, often used to convey rejection or refusal in digital communication.

Common Misconceptions

  • It is often mistaken for a high-five gesture due to the extended palm.
  • Some confuse it with the raised hand emoji (✋), which signals stop, not push away.
  • It may be misinterpreted as waving hello or goodbye.
  • Users sometimes think it means 'I can't hear you' when it actually indicates pushing aside.

Context Guide

On Dating Apps

In dating apps, 🫸🏽 can be used to politely decline someone's advances or indicate a lack of interest without harsh words.

Gen-Z Usage

Gen Z often uses 🫸🏽 ironically to over-dramatically reject 'bad vibes' or unwanted opinions in a humorous way.

At WorkUse Caution

May come across as too dismissive or negative for professional communication; use cautiously.

In MarketingGenerally Safe

Can be used in marketing to convey 'stop' or 'reject' in a playful manner, but avoid if the message is negative.

Use with Caution

  • In contexts where a more nuanced or respectful response is required
  • When communicating with authority figures or in professional settings
  • In sensitive or emotionally charged situations
  • When discussing serious or delicate topics
  • >-
  • In situations where a clear and direct verbal or written response is more
  • appropriate

Download Emoji Images

Download rightwards pushing hand: medium skin tone emoji in SVG formatSVG
Download rightwards pushing hand: medium skin tone emoji in PNG formatPNG
Download rightwards pushing hand: medium skin tone emoji in WEBP formatWEBP

Similar Emojis and Alternatives

Explore other emoji similar to 🫸🏽 Rightwards Pushing Hand: Medium Skin Tone emoji. These emoji share similar meanings, emotions, or use cases:

How to Type 🫸🏽

Windows
U+1FAF8 U+1F3FD
macOS
U+1FAF8 U+1F3FD
iOS
🫸🏽
GitHub
:rightwards_pushing_hand:
HTML
🫸🏽

More People & Body Emoji

Browse other emoji in the same category and discover more options related to 🫸🏽 emoji:

Frequently Asked Questions about 🫸🏽 Emoji

What does the 🫸🏽 emoji mean?

It represents a hand pushing away, often used to express rejection, denial, or a dismissive attitude.

How is 🫸🏽 different from ✋?

✋ is a raised hand often used to stop or high-five, while 🫸🏽 specifically depicts a pushing motion away from the body.

Can 🫸🏽 be used to say no?

Yes, it can be used to politely or firmly decline an offer, idea, or advance.

What does the medium skin tone mean?

The skin tone modifier adds a specific complexion, allowing users to represent themselves more accurately.

Is 🫸🏽 considered rude?

It can be perceived as dismissive or rude depending on context, but often used playfully among friends.

How do you type 🫸🏽 on a keyboard?

You can copy it from emoji pickers or use the Unicode sequence U+1FAF8 U+1F3FD on compatible systems.

Related Searches

rightwards pushing hand emoji meaningwhat does the pushing hand emoji meancopy rightwards pushing hand emojiemoji for rejectionhand pushing away emoji use🫸🏽 meaning in text

Discover More Emoji

Emoji Spark is the smartest AI-powered emoji search tool. Beyond the 🫸🏽 Rightwards Pushing Hand: Medium Skin Tone emoji, we provide detailed information, usage examples, and download options for thousands of emoji. Use our AI search feature to quickly find the perfect emoji by simply describing the emotion or scenario you want to express.

Most Searched Emojis

🤪

Zany Face

The zany face emoji depicts a silly, cross-eyed expression.

Learn More
🫣

Face with Peeking Eye

The face with peeking eye emoji depicts a smiling face peeking through fingers.

Learn More
😏

Smirking Face

A sly, smug facial expression with a mischievous grin.

Learn More
😮‍💨

Face Exhaling

The face exhaling emoji depicts a surprised or exasperated expression.

Learn More
🤮

Face Vomiting

The face vomiting emoji depicts a sickly, green face vomiting.

Learn More
😵

Face with Crossed-Out Eyes

The face with crossed-out eyes emoji depicts a dazed or unconscious expression.

Learn More
😵‍💫

Face with Spiral Eyes

The face with spiral eyes emoji depicts dizziness or confusion.

Learn More
🥺

Pleading Face

The pleading face emoji depicts a sad, puppy-eyed expression.

Learn More
💦

Sweat Droplets

The sweat droplets emoji represents perspiration, exertion, or heat.

Learn More
🖕

Middle Finger

The middle finger emoji depicts a hand gesture of defiance or disrespect.

Learn More
🫵

Index Pointing at the Viewer

The index pointing at the viewer emoji depicts a hand gesture.

Learn More
🫶

Heart Hands

The heart hands emoji depicts two hands forming a heart shape.

Learn More
🫶🏻

Heart Hands: Light Skin Tone

A pair of hands forming a heart shape, conveying love.

Learn More
🫦

Biting Lip

The biting lip emoji represents a flirtatious or suggestive expression.

Learn More
🦦

Otter

The otter emoji depicts a cute, playful otter.

Learn More
🌝

Full Moon Face

A bright, full moon face emoji depicting the moon's glowing surface.

Learn More
🧿

Nazar Amulet

The nazar amulet emoji symbolizes protection against the evil eye.

Learn More
▶️

Play Button

The play button emoji symbolizes starting or playing multimedia.

Learn More